PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24088.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 307aa    MW: 33753.9 Da    PI: 7.5842
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24088.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.8e-4371061100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv k+l++l+ ++reda++sl+yeAear+rdPvyG+vg+i+ lqq+
  mrna24088.1-v1.0-hybrid   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKILNELSATQREDAVNSLAYEAEARLRDPVYGCVGLISILQQR 92 
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              l+q++ +l  +++e
  mrna24088.1-v1.0-hybrid  93 LKQVQLDLYNARKE 106
                              *****999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8996107IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK ILNELSATQR  60
EDAVNSLAYE AEARLRDPVY GCVGLISILQ QRLKQVQLDL YNARKELATY MGPQAMLSIL  120
QPASYMGPQQ IQGGNAGTSS AVVPYNMSPM MGISTGGGSS GQLMVREQQQ QQQMFEAQQL  180
LAAREQQEML RSFEQNKQSQ EGHHQLRFNS GFDSVTGTGL AQMSPTSPAA ANNANIPPAL  240
ALGFDHSPYQ IQQQQQEHHH HHLQLQALLQ SQQQQSQQPQ QQQPPQLLPH KVEGEEGRSR  300
SVGPSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288064.10.0PREDICTED: LOB domain-containing protein 36
SwissprotQ9FKZ32e-85LBD36_ARATH; LOB domain-containing protein 36
TrEMBLM5W6J81e-118M5W6J8_PRUPE; Uncharacterized protein
STRINGVIT_07s0197g00020.t011e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.19e-76ASYMMETRIC LEAVES 2-like 1